Protein
- UniProt accession
- A0A0D3QHK9 [UniProt]
- Protein name
- Endolysin
- PhaLP type
-
endolysin
evidence: UniProt function annotation
probability: 99 % (predicted by ML model)
- Protein sequence
-
MSKVQFKQRAVTEAIFVHCSATKATMNVGLREIRQWHKEQGWLDVGYHFIIRRDGTIEEGRPVGVVGSHVKDWNSKSVGVCLVGGIDDKGKYEANFTPAQMHSLKEKLADLLDMYPDAEVKAHHDVAPKACPSFNLSRWLKTGELVTSDWG
- Physico‐chemical
properties -
protein length: 151 AA molecular weight: 16936,00000 Da isoelectric point: 7,77202 aromaticity: 0,08609 hydropathy: -0,39338
Domains
Taxonomy
Name | Taxonomy ID | Lineage | |
---|---|---|---|
Phage |
Escherichia phage P694 [NCBI] |
1572754 | Autographiviridae > Berlinvirus > Berlinvirus P694 |
Host |
Escherichia coli [NCBI] |
562 | Bacteria > Proteobacteria > Gammaproteobacteria > Enterobacteriales > Enterobacteriaceae > Escherichia |
Coding sequence (CDS)
Coding sequence (CDS)
Genbank protein accession
AJF40506.1
[NCBI]
Genbank nucleotide accession
KP090454
[NCBI]
CDS location
range 15450 -> 15905
strand +
strand +
CDS
ATGAGTAAGGTACAATTCAAACAACGCGCTGTGACAGAAGCAATCTTTGTCCACTGTAGCGCAACTAAGGCGACCATGAATGTTGGTCTGCGTGAAATCCGTCAGTGGCATAAAGAACAGGGCTGGCTTGATGTAGGCTACCACTTCATTATTCGACGTGATGGTACAATCGAAGAAGGCCGTCCGGTCGGAGTCGTTGGGTCTCACGTTAAGGACTGGAACAGTAAGTCAGTCGGTGTGTGTCTCGTTGGTGGCATCGACGATAAGGGCAAGTACGAAGCTAACTTTACTCCAGCGCAGATGCACTCTCTTAAAGAGAAACTTGCAGACCTGCTGGACATGTATCCAGATGCTGAAGTGAAAGCTCACCATGACGTTGCACCTAAAGCGTGTCCGTCTTTCAACTTGAGTCGCTGGCTGAAAACTGGCGAATTAGTAACTAGTGATTGGGGTTAA
Gene Ontology
Description | Category | Evidence (source) | |
---|---|---|---|
GO:0008270 | zinc ion binding | Molecular function | Inferred from Electronic Annotation (UniProt) |
GO:0008745 | N-acetylmuramoyl-L-alanine amidase activity | Molecular function | Inferred from Electronic Annotation (UniProt) |
GO:0009253 | peptidoglycan catabolic process | Biological process | Inferred from Electronic Annotation (InterPro) |
GO:0030430 | host cell cytoplasm | Cellular component | Inferred from Electronic Annotation (UniProt) |
GO:0032897 | negative regulation of viral transcription | Biological process | Inferred from Electronic Annotation (InterPro) |
GO:0042742 | defense response to bacterium | Biological process | Inferred from Electronic Annotation (UniProt) |
GO:0044659 | viral release from host cell by cytolysis | Biological process | Inferred from Electronic Annotation (InterPro) |
Enzymatic activity
EC Number | Entry Name | Reaction Catalyzed | Classification | Evidence | Source |
---|---|---|---|---|---|
3.5.1.28 | N-acetylmuramoyl-L-alanine amidase | residues in certain cell-wall glycopeptides |
Hydrolases
Acting on carbon-nitrogen bonds, other than peptide bonds
In linear amides
|
match to sequence model evidence used in automatic assertion
ECO:0000256 |
HAMAP-Rule:MF_04111 |
Tertiary structure
PDB ID: upi0005d8641e_model
Method: AlphaFold3 Non-commercial
Resolution: –
Chain position: A