Protein
- UniProt accession
- U5N0W6 [UniProt]
- Protein name
- Endolysin
- PhaLP type
-
endolysin
evidence: UniProt function annotation
probability: 99 % (predicted by ML model)
- Protein sequence
-
MPVINTHQNIAAFLDMLAVSEGTANHPLTKNRGYDVIVTGLDGKPEIFTDYSDHPFAHGRPAKVFNRRGEKSTASGRYQQLYLFWPHYRKQLALPDFSPLSQDRLAIQLIRERGALDDIRAGRIERAISRCRNIWASLPGAGYGQREHSLEKLVTVWRTAGGVPA
- Physico‐chemical
properties -
protein length: 165 AA molecular weight: 18538,00000 Da isoelectric point: 9,71250 aromaticity: 0,09091 hydropathy: -0,44545
Domains
Domains [InterPro]
Taxonomy
Name | Taxonomy ID | Lineage | |
---|---|---|---|
Phage |
Enterobacteria phage fiAA91-ss [NCBI] |
1357825 | Peduoviridae > Peduovirus > Peduovirus fiAA91ss |
Host |
Shigella sonnei [NCBI] |
624 | Bacteria > Proteobacteria > Gammaproteobacteria > Enterobacteriales > Enterobacteriaceae > Shigella |
Host |
Escherichia coli O157:H7 [NCBI] |
83334 | Bacteria > Proteobacteria > Gammaproteobacteria > Enterobacteriales > Enterobacteriaceae > Escherichia |
Coding sequence (CDS)
Coding sequence (CDS)
Genbank protein accession
AGX84604.1
[NCBI]
Genbank nucleotide accession
KF322032
[NCBI]
CDS location
range 6999 -> 7496
strand +
strand +
CDS
ATGCCGGTAATTAACACGCATCAGAATATCGCCGCCTTTCTCGACATGCTGGCCGTGTCCGAAGGGACGGCAAACCATCCGCTGACGAAAAACCGGGGCTATGACGTGATAGTCACCGGACTGGACGGGAAGCCGGAAATTTTCACCGACTACAGTGACCACCCGTTCGCACATGGCCGACCGGCGAAGGTGTTTAACCGTCGCGGTGAAAAATCCACGGCCTCCGGTCGCTATCAGCAGCTTTACCTGTTCTGGCCGCATTACCGCAAACAGCTTGCCCTGCCGGATTTCAGTCCGTTGTCACAGGACAGACTTGCCATTCAGTTGATCCGCGAACGCGGTGCACTGGATGACATCCGGGCGGGACGCATTGAGCGCGCCATTTCACGCTGTCGCAATATCTGGGCGTCCCTGCCGGGTGCCGGTTACGGTCAGCGTGAGCATTCACTGGAAAAACTGGTCACCGTCTGGCGTACCGCTGGCGGCGTACCGGCTTAA
Gene Ontology
Description | Category | Evidence (source) | |
---|---|---|---|
GO:0003796 | lysozyme activity | Molecular function | Inferred from Electronic Annotation (UniProt) |
GO:0009253 | peptidoglycan catabolic process | Biological process | Inferred from Electronic Annotation (InterPro) |
GO:0016829 | lyase activity | Molecular function | Inferred from Electronic Annotation (UniProt) |
GO:0030430 | host cell cytoplasm | Cellular component | Inferred from Electronic Annotation (UniProt) |
GO:0042742 | defense response to bacterium | Biological process | Inferred from Electronic Annotation (UniProt) |
GO:0044659 | viral release from host cell by cytolysis | Biological process | Inferred from Electronic Annotation (InterPro) |
Enzymatic activity
EC Number | Entry Name | Reaction Catalyzed | Classification | Evidence | Source |
---|---|---|---|---|---|
4.2.2.n2 | peptidoglycan lytic endotransglycosylase | MurNAc residue |
Lyases
Carbon-oxygen lyases
Acting on polysaccharides
|
match to sequence model evidence used in automatic assertion
ECO:0000256 |
HAMAP-Rule:MF_04109 |
Tertiary structure
PDB ID: upi000012ea44_model
Method: AlphaFold3 Non-commercial
Resolution: –
Chain position: A